PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7KG245000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 285aa    MW: 31053.5 Da    PI: 6.6696
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7KG245000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-181865148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT +Ed+llv+ v+q+G g+W+++++  g++R++k+c++rw +yl
  Pavir.7KG245000.1.p 18 KGPWTSQEDKLLVEHVRQHGEGRWNSVSKLTGLKRSGKSCRLRWVNYL 65
                         79********************************************97 PP

2Myb_DNA-binding54.23.3e-1771115147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          rg+ T++E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
  Pavir.7KG245000.1.p  71 RGKITPQEESIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 115
                          8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.3041365IPR017930Myb domain
SuperFamilySSF466891.65E-2916112IPR009057Homeodomain-like
SMARTSM007178.8E-161767IPR001005SANT/Myb domain
PfamPF002493.0E-171865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-231972IPR009057Homeodomain-like
CDDcd001671.74E-112065No hitNo description
PROSITE profilePS5129425.39666120IPR017930Myb domain
SMARTSM007176.6E-1670118IPR001005SANT/Myb domain
PfamPF002491.0E-1471115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-2473118IPR009057Homeodomain-like
CDDcd001671.93E-1075116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MEGAPLGWGR QEVDGWRKGP WTSQEDKLLV EHVRQHGEGR WNSVSKLTGL KRSGKSCRLR  60
WVNYLRPDLK RGKITPQEES IIVQLHALWG NRWSTIARSL PGRTDNEIKN YWRTHFKKGK  120
PSKNIERARA RFLKQRQEMQ SQQQQQQQLL QLAAGQVVAK DENQDGGGAR TGTTADEDDR  180
GSAVVDDACA APSSPAVAAE AAAAGHHHDE DLIMHDAMDF MCPMSCALLH GAVHQGGGTG  240
SCCGSTASDE YGSGEEDGAT WGSLWNLDGV VVDDAAAAVA CTLW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-261811827126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096201e-130AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978126.11e-146PREDICTED: transcription repressor MYB6-like
TrEMBLK3Y9D01e-146K3Y9D0_SETIT; Uncharacterized protein
STRINGSi010822m1e-146(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.12e-64myb domain protein 79